Home 

Gene Symbol:  
CDC7B_1944
Organism:  
Corynebacterium diphtheriae C7
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2038827..2040311 [1], 1485 bp
Product Function:  
Nitroreductase
Product Locus:  
 YP_005163389.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1485 bp
>CDC7B_1944|ThioFinder1545 Corynebacterium diphtheriae C7
ATGGATCGCCATACTGCAGATTTTTGGGCCACAACGGATAACGCTGCGACCGAATACACGCAGCTCATTC
TGGAGCGCAAAGAACATGGCATGGTCTTCCCTGTTCAAGGCCCCTTTTGGAACCATCAACCCTATCCCGC
AAAAATTGTTCCAGACGCCCCTCGTTTCCAGCTTCATACACACGCCATGTCCCCCACGGACATCGCTATT
GCGCAAGCGCTGGAGGATTCTCTGATCAGAACTCATCTGCGCGCAGAAGTCGACTGCAACTCGCCGACAA
GGACCCGATCTGAGGCGCAATCTTTTCAGTGGTCTCGGAATACAGCCTCAGGCGGAGGCTTATACCCAGT
GAACGTCTACAGATACAGCCCCGGAGATAGCCACCTGCCCGCTGGCCTGTACTTATTCAACCCCATAACC
TGCCAATGGCAGCAGTTGAGGGCTGATTCCCCACGAGGCGAACACTCGCGTTCTGCCGGTGAGACCCTGC
TGGTTACCGTGGAGTTTTGGCGTTCAGCGTTTAAGTACGGTGACTTTGCGTATCAAGCGACCTCCGTGGA
TGTGGGGATCGTTGTCGCGGCGTTAGTCTCCCAACTGGATGCAGCTGTTGGGCCGGTGGCGATCGACTGG
TCACCCGACGAGCTTGCTCTCTCCGAATTCCTTGGTAGTGATCCCCTCGACGAGGCCATATATTGCACGA
TCACGCTGCCTAACGGCTCCCCTTCAGACACTGTTACCGCTGGCGTGCCATCAGCCGTTCTCCAGACTGC
TGCTCGACTCGCGCACTCGGGAACGATGCCCGTACGTTTTCCTACCACTGTGGCTTTGCAAAAACAGCGG
CTCCGAGAAATGCAGAGTATGCGTGCGCCTTTTTCTACGGAAAGAATCGCCGCCCCGCCACCAGCAATAA
TCAAGCGAGGGTCCAGCTCTTTTGGGCGCTATTCCGGAGCTCCAATCGACGTGGGTGTGCTTACTCGCAT
GGTGCAACGCGGGCGTGCCACGGCCGCTTCACTCCTGGGAACCCCTCCTGAAACTGATTATTTCTTGGGT
ATCCAAGCAGCCGCGCTGTGTGTCAACGTCACGGGCTTAGCACATTCTCTTATAGCGGATAGTGAGACAT
ATTCTGAGTCTGCTCCTGCGCGCCCGTGTCCACAGCTTCCCGAGTTATTGCGCAACACCTATCTCCTGAA
AAACTACGACCCCCTGCGCAGCTCAGCCGTCTTAGTGCTGTGCGCAGATTTGCAGCGGGTAACCACTACT
TACGGCGCCTCTGGTTATCGGTGGGCATGTGCTGAGGTCGGGGCCTTTTGTCACGCTGTCTATACTGTAG
CGGCACAGGAACGGGTCTCTGTGGGCGCTGTGTTGGGGTTTGATGCTCAGTACCAGCGCGACTACCTCGG
TTTAGCAGATAACCTCGTCCCGATCCTCAACATTCTTGTGGGTGTGGATCGGCCTCATGCACGGTGGAGG
AACTCGTTACTATGA
 Primer design

Protein Sequence:494 a.a.
>CDC7B_1944|ThioFinder1545 Corynebacterium diphtheriae C7
MDRHTADFWATTDNAATEYTQLILERKEHGMVFPVQGPFWNHQPYPAKIVPDAPRFQLHTHAMSPTDIAI
AQALEDSLIRTHLRAEVDCNSPTRTRSEAQSFQWSRNTASGGGLYPVNVYRYSPGDSHLPAGLYLFNPIT
CQWQQLRADSPRGEHSRSAGETLLVTVEFWRSAFKYGDFAYQATSVDVGIVVAALVSQLDAAVGPVAIDW
SPDELALSEFLGSDPLDEAIYCTITLPNGSPSDTVTAGVPSAVLQTAARLAHSGTMPVRFPTTVALQKQR
LREMQSMRAPFSTERIAAPPPAIIKRGSSSFGRYSGAPIDVGVLTRMVQRGRATAASLLGTPPETDYFLG
IQAAALCVNVTGLAHSLIADSETYSESAPARPCPQLPELLRNTYLLKNYDPLRSSAVLVLCADLQRVTTT
YGASGYRWACAEVGAFCHAVYTVAAQERVSVGAVLGFDAQYQRDYLGLADNLVPILNILVGVDRPHARWR
NSLL