Home 

Gene Symbol:  
CDC7B_1943
Organism:  
Corynebacterium diphtheriae C7
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2037241..2038791 [1], 1551 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005163388.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1551 bp
>CDC7B_1943|ThioFinder1544 Corynebacterium diphtheriae C7
ATGACTACGCGCGTCGCCTACCTGTACTGCCCGGCGCGCAGTTTCCCAGCGCACGCCCTGCCTCCGCGTC
ATGAGCAGTGGATAGCAGTCCCCTCCAAGGTGTGCAGGGTCTGCCTTAACGCATGGGTGGATCGCACGGA
AGAGGCTGCGGACTGGGTTAAGGCTGCTAGAGTACCCGGCTTCATCAGACGTTGGCTGTCTGAGCGTGTG
CACTACGTCGAGCGCCCCTTGGGAGGTTGGAGGCTAGCAGCTACTGATGCGCAGTGCCTCTCCAGTTCTA
CGGTATTTATTCCGCCAAGCCCGTGCTGTACTGAGCACCACGATTGTGCTGCTAACGCAGAGGTTTCCGA
TCTCACAGGGCCTGTGTTAGCACCGTGTGGGACGGGGCCGATCACGGAGATTCGCCGTCCTGGAATGGTG
GTTTCCCGTGGAACCATGCCTACAGTGGGGTCTCGACCAGCATTCCATTGGAGTGGTCAGGCGCCGACCA
TTGCTGAGAGCCGAAAGCTGGCTCTTTGTGAGGCCGTCGAGCGCGCATCCGCATGTGGGAATGAGGGAGC
GGGAGGCGTCGATACGCATATTCCCCACGTCCCTGCCACTGATTTTGGGGTGGACAACGAACGGTGGAAC
CGTTCTTACGATCACTGCCGCAATTGGACACGCGCTATTCGCCTGGGAGATGAAACCGCATGGGCAGTCC
CCACGGATATGGCGTTTTTCTGGTCTGACGCACAAGCTCGTTTTTGCTTCGATTCCTCCAGCGGCGCCGC
GGTGGGGCGCACATGGGAGGACGCGGTGATGTCTGGGTTAGTAGAGGTCATTGAACGTGACGCTGTCCTG
TCCGTATGGCATGGTTCTATGACCGTCCCAGAGATCAATGTTGACTCGATCAATGATCGCACTTACCAGG
CAATGCTGCGGCACCTTCGCAGGCAAGGGCTGGTTATCCGCGCGTTTTACTGCCCGCTGAGTGTAGGAGT
TCCTGCTGTTATTGCGGTATGCATGGATACTGAGCGCACTTTCCTCTGTGTTGGGGCAGCTGCCGCACCC
GATCCCTATGTCGCAGTACGCAAAGCTCTACGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTTG
CTAGTACACGGTTATCAGACGCTGCCGCAGTGCGTGCGGACGGTTCCGGGGCAGCTCATCGCCTCAGCGT
TGCCGCTTCCGAGCTTATCGACGCCGCCGCTTTCCTCCTCCTGCCCCGTAAAGAGCTGCTCCGTGTCTCC
GACATCCCGGGGTGTCCTCGCTTGTCTCTCGTTGAGCTAGTCGAGCGTCTCAAAGCACATGGCTTTTACG
GCTATGTTGTCGACTTCACCCAGAGTTATCACCAAATGGTGGGGCTTTCAGCTGTCAAGGTTATTGTCCC
TGGTCTCTTGCCGCTGGAATATATCGGACAGCTGACTAGGGCATTGCATATGCCTAGGTTGAGGCAACAG
ATGACATGTTTTCGCGCTTTGGGCCTAGCCCCTCCCAGCTCACCTCCCCGTCTCAATCTTGTTCCGCACC
CGCTTCCTTAA
 Primer design

Protein Sequence:516 a.a.
>CDC7B_1943|ThioFinder1544 Corynebacterium diphtheriae C7
MTTRVAYLYCPARSFPAHALPPRHEQWIAVPSKVCRVCLNAWVDRTEEAADWVKAARVPGFIRRWLSERV
HYVERPLGGWRLAATDAQCLSSSTVFIPPSPCCTEHHDCAANAEVSDLTGPVLAPCGTGPITEIRRPGMV
VSRGTMPTVGSRPAFHWSGQAPTIAESRKLALCEAVERASACGNEGAGGVDTHIPHVPATDFGVDNERWN
RSYDHCRNWTRAIRLGDETAWAVPTDMAFFWSDAQARFCFDSSSGAAVGRTWEDAVMSGLVEVIERDAVL
SVWHGSMTVPEINVDSINDRTYQAMLRHLRRQGLVIRAFYCPLSVGVPAVIAVCMDTERTFLCVGAAAAP
DPYVAVRKALREVMADYPQSRLLASTRLSDAAAVRADGSGAAHRLSVAASELIDAAAFLLLPRKELLRVS
DIPGCPRLSLVELVERLKAHGFYGYVVDFTQSYHQMVGLSAVKVIVPGLLPLEYIGQLTRALHMPRLRQQ
MTCFRALGLAPPSSPPRLNLVPHPLP