Home 

Gene Symbol:  
Cp316_1663
Organism:  
Corynebacterium pseudotuberculosis 316
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1741613..1742626 [1], 1014 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005304243.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1014 bp
>Cp316_1663|ThioFinder1575 Corynebacterium pseudotuberculosis 316
ATGCGTACCACAGACCCCTGGCTGGCATTTCATATTTTTTATGGAGAAGACCCCTCTCACCTACTCCGCG
ACTGCCTATTACCTTTTGCTCATGCTTGCGTTGCAGAGGGGCTGGTAAGACGCTTCTTCCATATGAATTA
CTGGCTCGAAGGCGCTCATGTTCGCTTACGGTTAGAGCTGTCCAGTCCTGCGGATCGCGAGCGCGTCATA
TATAAAGCGCATCACGTTATCCAGCCATGGATCGATGCCCATCCTTCTAGTGCTCCCCAGTTGTCCTTGC
GTAATCCCGAAGGCTATCGGCGTCTTTTTGAACACGAATACCCTATGTCCAGGTTTTCTGATTACATCGA
TCAGGATGGCTTACCTCGCCTACAGCCAGATAACTGCATCCGAGAACGCTACTACGAGCGCGAGTATGAC
CGCTATGGCGGGCCAGCAGGGATGTCACTTAGCCAAGACATTTTTCAAGCCTCCACATTGTTCGTCGAAA
AGCTTTTGCGCTCTGGAGTTGTAGAAGCCCGCACCTCGCGTTTAGCCACAGCTGCTCTAGGAATGGTCTG
CACCGCGCATACCTTTTTATCCTCCGACGAGTCCATAAGTATCTTTTGGGAAAGCTACCACCGTGGCTGG
ACTTCCTCTTTTTCCATCCCCACCAGCTACACTTCCCCCGCTGCACAACAAAAAATCGCAGCCGAGGCTC
AGGCGCTCTCCCGCGCAGTCACGCCGTTCCGCGATGCATTACACCGCTATCCAGACGGTTCTTCCCTCCC
CGAACCTTATGCAACTTTTACTCGGCATATGGCCTCTGTTGTTGAGAAACTCCATGCTGCTCATGCTGCT
CAAGAGTTGGATTTTGGAGATTCTGCGGCGGAGGCTGGCCACACGTGGAAAGAAAATTCCACTTTTCTTC
TGCGTTCTTATGTGCATATGACCAACAACAGGATGTCCGTCAATATCTCGGATGAGGCATATCTGGCTTA
TTTATTACAGAAGTTATATCGGGAGACGCCATGA
 Primer design

Protein Sequence:337 a.a.
>Cp316_1663|ThioFinder1575 Corynebacterium pseudotuberculosis 316
MRTTDPWLAFHIFYGEDPSHLLRDCLLPFAHACVAEGLVRRFFHMNYWLEGAHVRLRLELSSPADRERVI
YKAHHVIQPWIDAHPSSAPQLSLRNPEGYRRLFEHEYPMSRFSDYIDQDGLPRLQPDNCIRERYYEREYD
RYGGPAGMSLSQDIFQASTLFVEKLLRSGVVEARTSRLATAALGMVCTAHTFLSSDESISIFWESYHRGW
TSSFSIPTSYTSPAAQQKIAAEAQALSRAVTPFRDALHRYPDGSSLPEPYATFTRHMASVVEKLHAAHAA
QELDFGDSAAEAGHTWKENSTFLLRSYVHMTNNRMSVNISDEAYLAYLLQKLYRETP