Home 

Gene Symbol:  
Cp316_1661
Organism:  
Corynebacterium pseudotuberculosis 316
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1737535..1739013 [1], 1479 bp
Product Function:  
Nitroreductase
Product Locus:  
 YP_005304241.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1479 bp
>Cp316_1661|ThioFinder1573 Corynebacterium pseudotuberculosis 316
ATGGATCGCCGTACTGCAGACTTCTGGAACACAGCTGATAACGCTGCTGCCGAATACACACAGCTTATTT
TGGAGCGCAAAGAATACGGCATGATCTCCCCAGCTCAAGGGCCTTTTTGGAACCATCAGCCCTATCCAGT
AAAGGTGGTCCCCGATGCTCTGTGCTTCCCGGTTCGCGCGCACACCATGTCTTCTACGGACCTTGCTATC
GCGCGCGCTATAGATGATTCCTTGTCCAGGACTCATTTACGCGCAGAAATCGACTGTAACTCTCCTACGC
GTACCCGAACTGAAGTGCAATCTTTTCAGTGGTCACGTAATACCGCCTCAGGCGGGGGCCTATATCCGAT
CAATCTCTATCGCTACACGCCCGGCGGTAGTCACCTGCCTGCTGGCTTGTATGTGCTCAATCCCATCACG
AGTCAATGGCAGCAGCTGATGAGTGGTGCCCTTCCACAAGACGCTTGGCCCTGCGCTCAAGGCGAGACGT
TGCTGGTTACCGTGGAATTCTGGCGTTCGGCGTTCAAATACGGTGACTTTGCTTATCAAGCGACTTCCGT
GGACGTAGGGATCGTTGTCGCGGCATTAGTTTCCCGGCTCGATGCCACTGCGGGGCCGGTAGCTATTGAC
TGGTCCCTCGACGAACACAAGCTTTCAGATTTCCTCGGTATCGATCCTCTCGATGAGGGCATATATTGCA
CAATCACCCTGCCACGCGATATCTCTTCAGATTTTTTTGTTCCCTCAGTCGATTCCTCTACTGAGGTCTC
CCGCGCGCACTCCGGAACAAAGCCTGTGCGCTTTCCCACCACTGTGGCTTTACAGAAACAACGGCTGGGG
GAAGCCCCCAATATACGCGTGCCTTTTTCTGCAAAAAGAACTCTGGCACCAACGCCGGTAGCCATCAGGC
GAGGTTCTAGTTCTTTTGGCCGTTATTCTGGGAAGGAAATCGGAGTTGATGTGCTCTCTCGTATGGTTCA
GCGCGGTCGTGCCACCGCTGATTCCCTCTTAGGTGTTTCACCGGAGTCCGATCTTTTTCCCTGTGTCCAT
GTAGCTGCGTTATGCGTCAATGTCCAAGGTTTATCCCACTCACTCATACCCGATGTTCGGACGCATACCC
CAGTATCTCCTGTACGCTTTTGCCCCCAGCTTCCTGAATTACTACTCAACACCTATCTGCTCAAGAACTA
TGATCCCCTGCGCAGCGCAGCAGTGTTGGTGTTGTGTGCGGATCTTCAGCAAATAGTCCTTGATTACGGG
GCTTCTGGCTATCGATGGGCTTGTGCTGAGATCGGGTTTTATTGTCAGTCGGCTTACGCGGTTGCGGCCC
AAGAACAGGTATCTGCGGGGGCGGTACTGGGCTTTGACGCTCGTTATCAACGCGATTACCTCGGTTTACC
GGATAATCTCATCCCGGTCCTCAACATTCTTGTGGGCGTGGATCGACCTCATGCTCAGTGGAGGAACTCG
TTACTATGA
 Primer design

Protein Sequence:492 a.a.
>Cp316_1661|ThioFinder1573 Corynebacterium pseudotuberculosis 316
MDRRTADFWNTADNAAAEYTQLILERKEYGMISPAQGPFWNHQPYPVKVVPDALCFPVRAHTMSSTDLAI
ARAIDDSLSRTHLRAEIDCNSPTRTRTEVQSFQWSRNTASGGGLYPINLYRYTPGGSHLPAGLYVLNPIT
SQWQQLMSGALPQDAWPCAQGETLLVTVEFWRSAFKYGDFAYQATSVDVGIVVAALVSRLDATAGPVAID
WSLDEHKLSDFLGIDPLDEGIYCTITLPRDISSDFFVPSVDSSTEVSRAHSGTKPVRFPTTVALQKQRLG
EAPNIRVPFSAKRTLAPTPVAIRRGSSSFGRYSGKEIGVDVLSRMVQRGRATADSLLGVSPESDLFPCVH
VAALCVNVQGLSHSLIPDVRTHTPVSPVRFCPQLPELLLNTYLLKNYDPLRSAAVLVLCADLQQIVLDYG
ASGYRWACAEIGFYCQSAYAVAAQEQVSAGAVLGFDARYQRDYLGLPDNLIPVLNILVGVDRPHAQWRNS
LL