Home 

Gene Symbol:  
Cp316_1660
Organism:  
Corynebacterium pseudotuberculosis 316
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1735970..1737508 [1], 1539 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005304240.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1539 bp
>Cp316_1660|ThioFinder1572 Corynebacterium pseudotuberculosis 316
ATGACTCCGCGCGTCGCATATCTACACTGCCCGGCGCGCATCCTGCCCCCGCGACATGAGCAGTGGGTAG
CGATCCCCTCTGACGTATGCAGGAGCTGTTTTACCGAGTGGGTAAGCCGCACTGAAGATGCTGCACACTG
GGTTAACGAGTCTAAGGTCCCGGCCTTCATCAGACGGTGGTTATCTGAGTGCTTGCAATATCGCGGGCAT
CCCCGAGGAGGCTGGAGGGTCGCGGCTACTGATGCTCAGTGCCTCGGCAGCTCCACGGTGTTTATTCCAC
CAAACCCATGCTGCGCTAAGCACCACACCTGGGCTGATAGCGCAAACCTTTCTGATCTCACAGGACCGGT
GCTGGCACCATGCGGGGTGGGACCTAATATCGCGGTTCAGCGTCCTGGAATAGTTGTTTCTCGTGGTACT
GTGCCGGCCTTAGGCCCTCGACCGGCCTTCCACTGGAGTGGTCAGGCACCAACTATTTCTGAGAGCCGTA
AGCTGGCTCTCTTTGAGGCTGTCGAGCGAGCATCAGCATGCCAAAGAACTGGGAAGCCAAGAGACTTGGG
CACTCGTGTTCCGCGTGTTCCTGCGGCTGACTTTGGAGTAGAAAATACCCGGTGGAACCGTTCTTATGGT
CGCTGTAAAGATTGGACAGCGGCAACTCGTCTGGGAGACGCAACTGAGTGGTCAATTCCCACAGACATGG
TGTTTTTCTGGTCTGACTCAAAAACTCGTTTTTGCTTTGATTCCTCCAACGGGGCTGCGGTAGGACCCAC
TTGGGAGGACGCGGTTATGTCCGGGTTATTGGAGGTCATTGAACGTGACGCGGTTCTAGCTGTATGGCAC
GGTTCTATGTCCGTTCCAGAGATTGACATTGGATCTATCAACGATCGTACTTATCTGGCAATGCTTCGGA
ATCTTCACAGACAAGGGCTGGTTATCCGCGCGTTTTATTGTCCGCTCAGCGTGGGAGTTCCCAGCGTTAT
TGCAGTGTGTACTGATGCCGCACGCACTTTCCTTTGCGTAGGGGCAGCGGCTGCGCCCGACCCGAATGTC
GCACTGCGCAAAGCGCTGAGGGAAGTTATGGCGGATTATCCACAGTCGCGTTTGCTAGCTGCTACGCAGA
TAACGGATGCCGCCGCAGCGCGTGCGGATGGTTCCGGGGCAGCTCACCGTTTAAGCGTGACTGCATCCGA
GCTCATTCATGCCGCCGCTTTCTTACTGCTTCCTCGAAAAGAACTAATCCGGGTCTCCGATATCCCAGGA
CAACCACAGTTGTCTCTCAAAGAGTTAGTCGGATGCCTCAATGCTCATGGATTCCACGGCTATGCTGTTG
ATCTCACCGAGAGCTACCACCAAATGGTGGGGCTCACAGCTGTCAAGGTCATTGTTCCGGGTCTTCTGCC
GCTGGAATATATCGGACAACTTACTCGGGCTTTACATATGCCGCGATTGAAACAACAGATGACATGTTTT
CGTGCTTTGGGGCTAACCTCTTCCAGCGCGAATCCCCGCCTCAATGTAGTTCCGCATCCGCTCCCCTAA
 Primer design

Protein Sequence:512 a.a.
>Cp316_1660|ThioFinder1572 Corynebacterium pseudotuberculosis 316
MTPRVAYLHCPARILPPRHEQWVAIPSDVCRSCFTEWVSRTEDAAHWVNESKVPAFIRRWLSECLQYRGH
PRGGWRVAATDAQCLGSSTVFIPPNPCCAKHHTWADSANLSDLTGPVLAPCGVGPNIAVQRPGIVVSRGT
VPALGPRPAFHWSGQAPTISESRKLALFEAVERASACQRTGKPRDLGTRVPRVPAADFGVENTRWNRSYG
RCKDWTAATRLGDATEWSIPTDMVFFWSDSKTRFCFDSSNGAAVGPTWEDAVMSGLLEVIERDAVLAVWH
GSMSVPEIDIGSINDRTYLAMLRNLHRQGLVIRAFYCPLSVGVPSVIAVCTDAARTFLCVGAAAAPDPNV
ALRKALREVMADYPQSRLLAATQITDAAAARADGSGAAHRLSVTASELIHAAAFLLLPRKELIRVSDIPG
QPQLSLKELVGCLNAHGFHGYAVDLTESYHQMVGLTAVKVIVPGLLPLEYIGQLTRALHMPRLKQQMTCF
RALGLTSSSANPRLNVVPHPLP