Home 

Gene Symbol:  
CpP54B96_1647
Organism:  
Corynebacterium pseudotuberculosis P54B96
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1771171..1772709 [1], 1539 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_005375651.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1539 bp
>CpP54B96_1647|ThioFinder1595 Corynebacterium pseudotuberculosis P54B96
ATGACTCCGCGCGTCGCATATCTACACTGCCCGGCGCGCATCCTGCCCCCGCGACATGAGCAGTGGGTAG
CGATCCCCCCTGACGTATGCAGGAGCTGTTTTACCGAGTGGGTAAGCCGCACTGAAGATGCTGCACACTG
GGTTAACGAGTCTAAGGTTCCGGCCTTTATCAGACGGTGGTTATCTGAGTGCTTGCAATATCGCGGGCAT
CCCCGAGGAGGCTGGAGGGTCGCAGCTACTGATGCTCAGTGCCTTGGCAGCTCCACGGTGTTTATTCCGC
CAAACCCATGCTGCGCTAAGCACCACACCTGGGTTGATAGCGCAAACCTTTCTGATCTCACAGGGCCGGT
GCTGGCACCATGCGGGGTGGGACCTAATACCGCGGTTCAGCGCCCTGGAATAGTTGTTTCTCGTGGTACT
GTGCCGGCCTTAGGCCCTCGACCGGCCTTCCACTGGAGTGGTCAGGCACCAACTATTTCTGAGAGCCGAA
AGCTGGCTCTCTTTGAGGCTGTCGAGCGAGCATCAGCATGCCAAAGAACTGGGAAGCCAAGAGACTTCGG
CACTCGTGTTCCGCGTGTTCCTGCGGCTGACTTTGGAGTAGAAAATACCCGGTGGAACCGTTCTTATGGT
CGCTGTAAAGATTGGACAGAGGCAACTCGTCTGGGAGACGCAACTGAGTGGTCAATTCCCACAGACATGG
TGTTTTTCTGGTCTGACTCAAAAACTCGTTTTTGCTTTGATTCCTCCAACGGGGCTGCGGTAGGACCCAC
TTGGGAGGACGCGGTTATGTCCGGGTTATTGGAGGTTATTGAACGTGACGCGGTTCTAGCTGTATGGCAC
GGTTCTATGTCCGTTCCAGAGATTGACATTGGATCTATCAACGATCGTACTTATCGGGCAATGCTGCGGA
ATCTTCACAGACAAGGGCTGGCTATCCGCGCGTTTTATTGTCCGCTCAGCGTGGGAGTTCCCAGCGTTAT
TGCAGTGTGTACTGACGCCGCACGCACTTTCCTTTGCGTAGGGGCAGCGGCTGCGCCCGACCCGAATGTC
GCACTGCGCAAAGCGCTGAGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTAGCTGCTACGCAGA
TAACGGATGCCGCCGCAGCGCGTGCGGATGGTTCCGGGGCAGCTCACCGTTTAAGCGTGACTGCCTCCGA
GCTCATCCATGCCGCCGCTTTCTTACTGCTTCCTCGAAAAGAACTAGTCCGGGTCTCCGATATCCCGGGA
CAACCACAGTTGTCTCTCAAAGAGTTAGTCGGATGTCTCAATGCTCATGGATTCCATGGCTATGTTGTTG
ATCTCACCGAGAGCTACCACCAAATGGTGGGGCTCACAGCTGTCAAGGTCATTGTTCCGGGTCTTCTGCC
GCTGGAATATATCGGACAACTTACTCGGGCTTTGCATATGCCGCGATTGAAACAACAGATGACATGTTTT
CGTGCTTTGGGTCTAACCTCTTCCAGCGCGAATCCCCGCCTCAATGTAGTTCCGCATCCGCTCCCCTAA
 Primer design

Protein Sequence:512 a.a.
>CpP54B96_1647|ThioFinder1595 Corynebacterium pseudotuberculosis P54B96
MTPRVAYLHCPARILPPRHEQWVAIPPDVCRSCFTEWVSRTEDAAHWVNESKVPAFIRRWLSECLQYRGH
PRGGWRVAATDAQCLGSSTVFIPPNPCCAKHHTWVDSANLSDLTGPVLAPCGVGPNTAVQRPGIVVSRGT
VPALGPRPAFHWSGQAPTISESRKLALFEAVERASACQRTGKPRDFGTRVPRVPAADFGVENTRWNRSYG
RCKDWTEATRLGDATEWSIPTDMVFFWSDSKTRFCFDSSNGAAVGPTWEDAVMSGLLEVIERDAVLAVWH
GSMSVPEIDIGSINDRTYRAMLRNLHRQGLAIRAFYCPLSVGVPSVIAVCTDAARTFLCVGAAAAPDPNV
ALRKALREVMADYPQSRLLAATQITDAAAARADGSGAAHRLSVTASELIHAAAFLLLPRKELVRVSDIPG
QPQLSLKELVGCLNAHGFHGYVVDLTESYHQMVGLTAVKVIVPGLLPLEYIGQLTRALHMPRLKQQMTCF
RALGLTSSSANPRLNVVPHPLP