Home 

Gene Symbol:  
HMPREF0877_1441
Organism:  
Weissella paramesenteroides ATCC 33313
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
6720..9155 [-1], 2436 bp
Product Function:  
possible lantibiotic epidermin biosynthesis protein EpiB
Product Locus:  
 ZP_04783466.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2436 bp
>HMPREF0877_1441|ThioFinder1616 Weissella paramesenteroides ATCC 33313
ATGCGAGGTGGAGTTTTTAAAAGGCATAGTAATTTAACATTGAAACAGGCACGAGACTTCTATTTACTAA
ATAATGATGCCCAAAAACAGCAGGTTGATAAATTTTTACTAGATAATTATCATCAATCCGATATCGCACG
ATTTGGTAAATTTTTACGAATGACTAGCAAAACAACAGTACGCAATGATTTTGGAACTTTTAATAACAAG
CGTGATGTTATTGCAGATAAAGAAAATTTACACCAAGAAATACAACAAATGCATGAAAAAATTTTTGAAG
ATTGGAAAAATGAAAATGAGACTTTATGGTTGTCCGACCGTGTTGTGAATAATGAAGTTAATTTTGAGTT
TGACGCCTATATTGCAGTTGATGAAGAAAATGCAATGCCATTTGTAGTAGCAAAACAATCAATGTTAGGG
CAATTCTTAGTCAGAGCAATTGATGGAGTCAACAGCCAAGATGAATTTCATCATGATGAAATCGTTAATT
TTTTAATTCGAAAGGGTTTACTGGTTGCTAAAAACAGCCAATCAATGGCTGAGCTAACAGCAAAAATAAA
AGAAAAACAGGTACCACAGTCCACAAAGGCAAGTAAAGAAAAAATTGAATATTTGGGTAATCTTAATCGT
GTTGTAACAATACTAAGAAAAGTACAATACATAAATAGACAACATACATTAATTGGCACTTGGGTTAAAC
ATTTTACTGATCAATATGGAGAAAGGCACAAGGTTGATTTAAAAGAAGCCTATCAAAATTATAATGAATT
TCGAAAAAAAAATAATTTGATAAAAACTATCACGCCAATTGATTGGATACCTATAAATCAAATGTTTAAT
GACATTGTCGAATTGACCGATCAAGATTTACAGAAAATAGAGCAAAAGTTGAATGTAGCAAATAATGATT
TATTTAAAATAAAGTTAACAGTTGGTGTGGAAGAACGACAAAAGGGTAACGCTGAACTAATTGGTTTGTT
TTCGGTCGCTGAAAATGCATATCTAACAGCATACACAAATTATTTTGTTGCGCAACAGCCCAAAATGTTT
TATGCAATTGATGTGGTGGCAAGTTATGCGCCAGAATTAGGCATGTATGCAACGAATTCTGAAAATAAGA
TAAAAATGAGTTCACTAACAAAAAATGAAAGTGATTTGCAAGTTTCTGATTTATCAATTGTTGTTGTCAA
GGGAGAGCTAGTTATTATTAATCGAAATGATAATCAGTGTGTCATTCCCTATAATCCAACAGCCATCTCT
TATGATTATGATGTTGAAAGTGGACTCGCACATTTTTTACAGTCTTTGTCAAATTATATGTTGAATCTGC
CAAATTCAAACATCTATTTGCCTGCCATTAGGGCTAATTCATTTATACCAGAGATTCGATATAAAAACAT
AATTATTGCCCCCAAAACTTGGCAAATAGTTACGTCAAAAATTCAGAACAAGAATCAAGCAGAAGGGTTA
ATTGATCAATTACGAATGCATAAAGTAGTACCGAATCTGTTTAGCATATTAGAAAACGGTCAAAAATTCC
CAATCAACTTAAATAGTCCAATCGGTCAATGTTTGTTAGAAAAAAGTTTAATTAAAAAAAATTTTATTTA
TATTGTACAAGATGTAGAGTTAGAATCATCCGATGCGTTAAGAAACAATACTTTTGTATCAGTTACAACG
GGTACTAGAAAAATTGAAAATAATTTTGAACCTATGTTTAATTATCCGAAAATTCCTAATTTGGATTGGA
AAACCATTGTGATTGTTGTACGTAAACAGAACATAGATGCAGTGTTGGATGAAATGTTGTCCTACGCTAA
AACACGGATTAATCGTTATTTTTTTGTTAGATATGTTGATACAATAGGCTGGCAAATTCGATTACGTATA
CCAATTTCATCTGAAAACGTGTCGTCGATTGCACGTGATAGTATGTCGTTTTCTGGTGTTAGTGAAGTAT
TGATTAGACAGTATTTTCCGGAGAAAAGCCGTTATGGTGATGAATTGATATCAAATGCGGAATCAGTGTT
TGTGGCAGAATCGGTGCAAACTAAGACAGTTCAGCAAGTTTTAAATCAGTTCTCAATTGATGAAAAAATA
TTGTTGGTAGCATTTGACTTATATAGATGGAAATTTAATTTTAATAATTTAGAAATGGTTTTACATCAAA
GTAAATTATTTCAAGGAAATATTGCAAATATTTTAGAAGGATTGCAAGAGTTAAAACAAGTGACGCAGGA
TGTAAATCAGCTAACTAATGAGTATATCGAAAAACTTATAGAAAAATATAATAATTCTTATGCTCAAGAA
GTGTGGCGTTCATTGCTACACATGCGCATTAATCGTTGGATTGGCATTAATCGTACAATTGAAAATAACA
TGTTAGTAATTTTTTTTAAGATTATGAGGAAGGTACACATTACTAATGAAGTTTAA
 Primer design

Protein Sequence:811 a.a.
>HMPREF0877_1441|ThioFinder1616 Weissella paramesenteroides ATCC 33313
MRGGVFKRHSNLTLKQARDFYLLNNDAQKQQVDKFLLDNYHQSDIARFGKFLRMTSKTTVRNDFGTFNNK
RDVIADKENLHQEIQQMHEKIFEDWKNENETLWLSDRVVNNEVNFEFDAYIAVDEENAMPFVVAKQSMLG
QFLVRAIDGVNSQDEFHHDEIVNFLIRKGLLVAKNSQSMAELTAKIKEKQVPQSTKASKEKIEYLGNLNR
VVTILRKVQYINRQHTLIGTWVKHFTDQYGERHKVDLKEAYQNYNEFRKKNNLIKTITPIDWIPINQMFN
DIVELTDQDLQKIEQKLNVANNDLFKIKLTVGVEERQKGNAELIGLFSVAENAYLTAYTNYFVAQQPKMF
YAIDVVASYAPELGMYATNSENKIKMSSLTKNESDLQVSDLSIVVVKGELVIINRNDNQCVIPYNPTAIS
YDYDVESGLAHFLQSLSNYMLNLPNSNIYLPAIRANSFIPEIRYKNIIIAPKTWQIVTSKIQNKNQAEGL
IDQLRMHKVVPNLFSILENGQKFPINLNSPIGQCLLEKSLIKKNFIYIVQDVELESSDALRNNTFVSVTT
GTRKIENNFEPMFNYPKIPNLDWKTIVIVVRKQNIDAVLDEMLSYAKTRINRYFFVRYVDTIGWQIRLRI
PISSENVSSIARDSMSFSGVSEVLIRQYFPEKSRYGDELISNAESVFVAESVQTKTVQQVLNQFSIDEKI
LLVAFDLYRWKFNFNNLEMVLHQSKLFQGNIANILEGLQELKQVTQDVNQLTNEYIEKLIEKYNNSYAQE
VWRSLLHMRINRWIGINRTIENNMLVIFFKIMRKVHITNEV