Home 

Gene Symbol:  
HMPREF0877_1438
Organism:  
Weissella paramesenteroides ATCC 33313
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3845..4981 [-1], 1137 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_04783463.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1137 bp
>HMPREF0877_1438|ThioFinder1613 Weissella paramesenteroides ATCC 33313
ATGACCAAGTTAATTAATTATTTGTGGCATAGACAAATTTTGGCAAAGTCTGAAAAATATCAATATAGAC
AGATAAACAAACCATACGTGGCAAATTTTTACGCACCAGACCAAATGGGTATTCAAGGATCACATGAAAC
TTTAGGAAATTTTGATTGGGTCAATCAATCCAAAGCCTTTTATGAGTTCGTTGAACGGACAAGCTCGAAA
AGTAGTATGGATGTGAATAATGGCAAAAACATTAATTTTGAGGGATTAGGGTTTGATTGGTTTGTTAATG
AATTCCAAGCAGTGAGTCGATATGATATTGCAACTGATTACTTTTCTGGTAACTTACGTCAAGTACCATA
TATTTTTGGACATTATCTAGATGAGCGGTCATATGATGGGCATGTTTTCAGGGGAAATTCGAATGGGGCT
GCTTTAGGTAGTACGTATAAAAAAGCGTTACATAGTGCAACGTTAGAACTTGTAGAACGTGATAAGCTAT
TGTCCTTTTGGCTGGGGGATAGAGGTAAGTTAATACTAATAGATCATCAATATACTGTTATACCTAAATA
TGTAAACGGTTATTATGTACAAAGTTTTTTGATTGACGCAGAGCCATTTCAAATTTACCTTGTATGGACA
ATTTTGGTTAAAGAAGACTCCACCAATGATGAATTTACTAGTTTTAGTGGATTTGGATCAGCATTAGATA
TTGTTGAAGCATTGGAAACATCATTTTCTGAAGCGCGTAGTTTACAGAACAATCATTTAACTGAAAACAA
TATTTCTGAAAAAATTAAAAAAACTTTGTCAATTACGGACGGTATCTACGATTTGAACGATCAAATTTAT
TATTGGGGTTCTGTGCAGGCTTTGCGCGAGTTCCGTAGGATGGTTGCCGGAATTGATACAGTTACCATAG
AAGATATACAAAAGGAAAGCGTTAAAAAAGAATTAATGACTATTGTAGAAGAAGCATATCAGGAGTTATG
GGTATTAGATCTAACAGATTCAGAACTACAAGAATTGTCCTTGTTTTCATTAAAGGTTTTTTCGCCCAAT
GCTAAAAATATGTACTTTAAATTGAATATGAGTCGGTTAAAAATGCGCGAAAATGTATTTCGACCAAAAG
TGTTTCCATTAGCTTAG
 Primer design

Protein Sequence:378 a.a.
>HMPREF0877_1438|ThioFinder1613 Weissella paramesenteroides ATCC 33313
MTKLINYLWHRQILAKSEKYQYRQINKPYVANFYAPDQMGIQGSHETLGNFDWVNQSKAFYEFVERTSSK
SSMDVNNGKNINFEGLGFDWFVNEFQAVSRYDIATDYFSGNLRQVPYIFGHYLDERSYDGHVFRGNSNGA
ALGSTYKKALHSATLELVERDKLLSFWLGDRGKLILIDHQYTVIPKYVNGYYVQSFLIDAEPFQIYLVWT
ILVKEDSTNDEFTSFSGFGSALDIVEALETSFSEARSLQNNHLTENNISEKIKKTLSITDGIYDLNDQIY
YWGSVQALREFRRMVAGIDTVTIEDIQKESVKKELMTIVEEAYQELWVLDLTDSELQELSLFSLKVFSPN
AKNMYFKLNMSRLKMRENVFRPKVFPLA