Home 

Gene Symbol:  
HMPREF0877_1440
Organism:  
Weissella paramesenteroides ATCC 33313
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5867..6730 [-1], 864 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_04783465.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:864 bp
>HMPREF0877_1440|ThioFinder1615 Weissella paramesenteroides ATCC 33313
ATGAAGTTTAAAAATAATAAACTTATCTTGAATGAAAAGTATTCATTAACAAAATCAGTTGTACGTATGG
CTAGATTGACATCTGCAGGCTATATTAGTCGTGCATACGATGGAACCCACAGGATACAAATTGAAAATTT
AACAAATCAAGAAATCAATGACGCCTTGAGCATGTTTAAAAATGAAAATATTGACATGATTACATCTGAG
GAACGAATTTTTCAAAATCAATACCAGATGGAATTAGTGCGTAAATTACATCGTATTTTTTTCGAACGAT
TTGAATCAAAGTATTTTACATCAGTCAAAATCATAGATATTTTCCCTGTTGTTAATTTTGTTGCGAAGTC
TTTGGACAATCAAGGTGTTCTTGGATATGAGGGAACACAGTCACATCTTTCTCATTTATGGGCATACATG
GTAGGGAGATTAGATAAAAAGCGCCGTGTTGAATTTTTAGATTTTTTAGAACGTTATTGTCAACAATACA
TGAATCGATTTTCTGATTTAGAAGAATGGTCGGAAATTTTGACGGTGTTGCCAAATGTGAAGCAGGGAGT
AAAAACCGGTGGAATTACATTTTGGAGTCCATATCAATTTAATCCTAATAACTATGCCACAGCATTGCAT
AAGGCGACATATGCGAACCAAACAAAAGTTGATTTAATTTCCCATAATGCGGTTTTAATATTTAATCGCT
GGTATATCAATATTTTATATGAAAACCTAACCCTATTAAACTTGAACATTATTGATAAATATATTTTGAA
TTATGCTATTGCATCACAACGGTATGATATTCGTAAGTCGATTGAGTATTATCATGAATTTGGAAAGGAG
CGCATATGGGAACTTGGAGAATAA
 Primer design

Protein Sequence:287 a.a.
>HMPREF0877_1440|ThioFinder1615 Weissella paramesenteroides ATCC 33313
MKFKNNKLILNEKYSLTKSVVRMARLTSAGYISRAYDGTHRIQIENLTNQEINDALSMFKNENIDMITSE
ERIFQNQYQMELVRKLHRIFFERFESKYFTSVKIIDIFPVVNFVAKSLDNQGVLGYEGTQSHLSHLWAYM
VGRLDKKRRVEFLDFLERYCQQYMNRFSDLEEWSEILTVLPNVKQGVKTGGITFWSPYQFNPNNYATALH
KATYANQTKVDLISHNAVLIFNRWYINILYENLTLLNLNIIDKYILNYAIASQRYDIRKSIEYYHEFGKE
RIWELGE