Home 

Gene Symbol:  
SchaN1_010100008075
Organism:  
Streptomyces chartreusis NRRL 12338
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
8597..10156 [1], 1560 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_09951908.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1560 bp
>SchaN1_010100008075|ThioFinder1634 Streptomyces chartreusis NRRL 12338
GTGACGGCCCCCGCCGAGGCCTGGGCACGGCGCGCCCCGGTCGACCTCCCGGGCCCGGAGGGCGACAACA
GCATCGCCCGCGAGCCCCTGTGGTACGCCTACGGTGCCGGCGACGACCGCCCGGAACCACCGCCGTGGAC
CTGGGCGGCCACGCCCCCGCCCGACTCCCACGTGCCGCCCCCGCCACCGCGCCCGGCGGGACCGGCGACC
CTCCTGCCCCTGGGCACGACCGACCGGCTGTCCGCGATGCCGTACCCCCGGCTCCCGGCCGGGGCCCACC
CCGCACCGGACGCCCTGCTCCACGCCCTCACCGCCACGTTCGCACCCCTGCGCCGCGAACCGGAGAACCC
GTACAACGAACACCGCCCCTACGCCTCACCGCGCTGCCTCTTCCCGGTCCACGCCTTCGTGGGGGACGGT
GACGCGTGGCGGCTGCTGGAACCCACCCGGCACACCCTCACGGGCCCCGGCACAGGGACCCCGAGCCGCA
TCGCCCTGACCGGCCGCTACACGGCGATCCCACTCGCGTACCAGTGGTTCCGGGGCTCGCTGGTGGCGAT
CGAAACGGGCATGGTGCTGCGCGCGTTGACGCTGGGCCTGGAGCTCTTCGGGGTGCCGGCGACACTGACA
CCCCCGACCGAGGGTGCATCGGGCCTGCTGCGCGAACTGGGTGTGGAGCACACCTGGGAGTGGTCGCTGC
CGTGGTTGATCGACGTGGGTGAGCCACGCCCCGCCGTACACCGACCGGCTGGGCCGGAATCCCCGGTCCC
CGACGGAGATCCGTCCCTCACCCAGGTCATCGACGTGGACAGAAGTGCCGTGAGGGGCACGGGGCCGCAT
CCGATACGCGGCTACCGCCGCGTGGGCGCGACCAGCCACACACGACCCGCGCCCGTCACCACAGCCGTAC
CCCCCACCCTGCCCCACTCCCTCCGCACCCCCACCTGGTCAGAACTGCTCTGGCACCGCCACTCCGGCCG
CATGCCCAGATCCCTGCACGGCATGGACTCGGCCAAGTGCCACACCCCCCTGCCCGCCCGAACCCTGGCC
ACCACCCTGGCCTGGCTGGGCGTCCCCCCACCGCACCCGCTCCTGGCCGCCGCCTTCGACGCGGTCACCG
TCACCGCGGTCGTCCAGCACGTCGACGGCCACACCCCCGGCGTGCACCGCGTCCGCGACGGCTCCGCACA
CCTGGTCCGGGACGACCCCACCGCCCCCGCCGGCCTGGAGGCCAACTACGGCTACGGCCTGACTCCGGTC
AACGGCTGCGGCATCGCCAACGCCCCCCTCACCGTCTTCTTCTCGGTCCGCCCCCGCGAACTCTTCGCCC
GCTTCGGCCCCACCGGCTGGAGCGCCGCCCAGCACGCCTGCGGCTGGGCGGTCCACGGCCTGTGCCTCGC
CGCGGCCGCCGAGGGGCTCTTCGCCCGGCCGGTCCGGGCGTTCAAGGAGATCCAGACCAAGGAGGTCGTC
GGCCTCGGCGAGGACGAGACGATCGTCCTGTCCGCGGTGGTCGGCGTACCGCGCGAGACCGGGGGTGCCG
TGCTGGACCTGCGCACGTAA
 Primer design

Protein Sequence:519 a.a.
>SchaN1_010100008075|ThioFinder1634 Streptomyces chartreusis NRRL 12338
MTAPAEAWARRAPVDLPGPEGDNSIAREPLWYAYGAGDDRPEPPPWTWAATPPPDSHVPPPPPRPAGPAT
LLPLGTTDRLSAMPYPRLPAGAHPAPDALLHALTATFAPLRREPENPYNEHRPYASPRCLFPVHAFVGDG
DAWRLLEPTRHTLTGPGTGTPSRIALTGRYTAIPLAYQWFRGSLVAIETGMVLRALTLGLELFGVPATLT
PPTEGASGLLRELGVEHTWEWSLPWLIDVGEPRPAVHRPAGPESPVPDGDPSLTQVIDVDRSAVRGTGPH
PIRGYRRVGATSHTRPAPVTTAVPPTLPHSLRTPTWSELLWHRHSGRMPRSLHGMDSAKCHTPLPARTLA
TTLAWLGVPPPHPLLAAAFDAVTVTAVVQHVDGHTPGVHRVRDGSAHLVRDDPTAPAGLEANYGYGLTPV
NGCGIANAPLTVFFSVRPRELFARFGPTGWSAAQHACGWAVHGLCLAAAAEGLFARPVRAFKEIQTKEVV
GLGEDETIVLSAVVGVPRETGGAVLDLRT