Home 

Gene Symbol:  
SchaN1_010100008070
Organism:  
Streptomyces chartreusis NRRL 12338
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
6687..8600 [1], 1914 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_09951907.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1914 bp
>SchaN1_010100008070|ThioFinder1633 Streptomyces chartreusis NRRL 12338
ATGCCGACCACTGACCCGACCACCGCGGTGCACGCCGGCCCCGCACTGCCCCCGACGGCCTACGACGACT
GGCTGCCCGCCTTCGCCCCCCTGGCCCGAGCGACCGGGGCCACCGTCTCCGTCAACCTCGGCTGGGACCT
GGCCTGGGAGCGCGACCTCCTCACGAAGGCACGGGGACCGCACCTGTCCGTGCGGGTGTACGACGACGAG
GTGATGGTCGGCCCCTTGTCGGTGCCGGGCACCTCCTCCGGCTGTGCCGCCTGCGCCGAGGTGCGCGAGC
GCACCGTCCTCGACCACCCCCTCGTGGGCGACCTCACCCAGGCCACGCGGGTCCCCGCCGCCCCCGCCCC
CCTGCTGCCCGATCTGCTGCGCACCGGCCTGGAGCACCTGGCGGACCGCCCCCTGGCGCCCGGCGAGGCC
TACTCGGTGACCGTCCACGGCACGCGCCGGCACCGCATCGCCCGCAGCTTCCACTGCCCGGTCTGCGGCC
CGTCCCCCGAGGACCTGGTGAGCACCGTGCCCCCGGCCCCCCGCTCCCTGCGCTCCCGGCCCGCCGTACC
CGGTGACGCGACGCGCACCGCCGCCGGCCGTCTCGTCGAGCCCGGCTTCCTGCGGGACCGGCTCGTCGAC
GACCGCTTCGGGCCGGTCCGCGCGATCCTGCGGGAGTCGCACGCCCCGTTCGCGATGAGCATGGCGGTCG
TCGCGGACGCCCCGGCGATGGGCCACGGCAGGGCCCGTACGTTCGCGGAGACCGAACCGGTCGCCGTCCT
GGAGGCGTACGAGCGGCTCGGCGGCTACCCGTACGACGTCCCCCTGGTGACCGGCCGCTCCTACCGCGAG
GTCGCCGGGCAGGCCGTCGACCCGGGCAGCCTCGGCCGCTACACCGCCGAGCAGCTCGCCCACCCCACCA
GCAGGGCCACGCCGTTCACGGCCGACACCCCGATGGACTGGGCCTGGGGCCATGACCTGGCCGACGGCAC
TCCCCTGCTGGTGCCGGCCGACCACGCCTTCTACCAGTACGAGTACGCCTTCCGCCGCGACCGGCGCGCC
GCCCGCGTGGCCAGTGCCGCGAACCGCAGGCACTACTTCTTCGACTGCTCCAGCGGCTGCGCGGTCGGCG
CCAACTACGAAGAGGCCGCCCTGCACGCGCTGTTCGAACTCGCGGAGCGGGACGCCTTCCTCACGTCCTG
GTACCGGGCCCGCCCGCTCCCCCACGTCCCGGTCTCCACGCTCACCGACCCCACGAGCCGGGCCATGGTC
GAACTGATCCGGGCCCGCGGCTACGACGTCCACCTCCTGGTCGCCACCCGGGACATCGGCCTGCCGGTGG
TGTGGGTCATCGCCGTGAACGAGGAGAACCCCTTCCCGGCGACCTTCTCCTCCGCCGGTTCCGGGGCCGA
GCCCGAATCCGCGATCCGCGGCGCGCTGCGCGAGGTCGCCCAGCTCGTCACGAACCCGGTCGACTGGACC
CGCGAGCAGGTCGAGCGGATGGTCGAGGACCCGTGGCTCGTGGAGGACCTGGAGGACCACGTCCGGTTCT
CCTCCGTCCCCGAGACCCGCGACCGCGCCCTGGCCGGACTCGGCGGCCCGGCCGTCACGCTCCAGGAGGC
GTTCCCCGACTGGCCGGGGCGGCTGGAGCGGGCGGCCGGCGGCGACGTACGCGGCACCCTGGAGTACGTG
GCCTCGCTCTTCGCCGACGCGGGCCTGGACCGGATCGTCGTCGTCGACCAGACCAGCCGGGAACACGCCG
ACGCCGGCATCGCGGTCGCCCGTGCCGTCGTCCCCGGCATCGTGCCGATGTGCTTCGGCCACGCCCAGCA
GCGCCTGGCCGGACTGCCCCGGCTCCGCGCCGCCCTGCGCGGCACGGACCAGGAGCACCGGGCGATCCCC
TACGACCCCCACCCGTTCCCGTGA
 Primer design

Protein Sequence:637 a.a.
>SchaN1_010100008070|ThioFinder1633 Streptomyces chartreusis NRRL 12338
MPTTDPTTAVHAGPALPPTAYDDWLPAFAPLARATGATVSVNLGWDLAWERDLLTKARGPHLSVRVYDDE
VMVGPLSVPGTSSGCAACAEVRERTVLDHPLVGDLTQATRVPAAPAPLLPDLLRTGLEHLADRPLAPGEA
YSVTVHGTRRHRIARSFHCPVCGPSPEDLVSTVPPAPRSLRSRPAVPGDATRTAAGRLVEPGFLRDRLVD
DRFGPVRAILRESHAPFAMSMAVVADAPAMGHGRARTFAETEPVAVLEAYERLGGYPYDVPLVTGRSYRE
VAGQAVDPGSLGRYTAEQLAHPTSRATPFTADTPMDWAWGHDLADGTPLLVPADHAFYQYEYAFRRDRRA
ARVASAANRRHYFFDCSSGCAVGANYEEAALHALFELAERDAFLTSWYRARPLPHVPVSTLTDPTSRAMV
ELIRARGYDVHLLVATRDIGLPVVWVIAVNEENPFPATFSSAGSGAEPESAIRGALREVAQLVTNPVDWT
REQVERMVEDPWLVEDLEDHVRFSSVPETRDRALAGLGGPAVTLQEAFPDWPGRLERAAGGDVRGTLEYV
ASLFADAGLDRIVVVDQTSREHADAGIAVARAVVPGIVPMCFGHAQQRLAGLPRLRAALRGTDQEHRAIP
YDPHPFP