Home 

Gene Symbol:  
SchaN1_010100008065
Organism:  
Streptomyces chartreusis NRRL 12338
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4736..6700 [1], 1965 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_09951906.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1965 bp
>SchaN1_010100008065|ThioFinder1632 Streptomyces chartreusis NRRL 12338
GTGACGGTGACCGATGTGGACAGGACCCCGGCGAGGACGGCCGCAGGCGCCGGTGCCGCGTCCCTCAAGG
CCCGGCCGGGGCTGCACTACGCGCCCGTGCCGGGGGGCGTCTACTTCAGCGGGACGCGCGGGCAGTTCGT
GCTGCGCGGCTCGGAGCTGCTGTACGCGGTGGCGGACGGCTGCGTGCCGCTGCTCCGGGCGGGGACGACG
GAGGACGCCCTGGTCGCCGAGTTCGGCACCGAGCGTGCCCGGCCGGCGGTACGGCACCTGCTCACCAAGC
TCCGCGAGAACGGCCTGCTGCTCGACCCGGCCGCGCTCACCGAGCCGGAGCCGCCGGCCGAGGTGGCCGC
CCTGCACGCCGGCACGCTGGCGCGTCTCACCGCCCGCCTGGACGACCCGTACGCGGCGTTCGCACGCCTG
CGCCGCGCCCGGGTACGGCTGCACGGCCCGGCGACGGCGACGGCTCCGGCCCTGCGCGGACTGCGCCGGG
CAGGCGTCACCGACGTGACGGCGACAACCGTCCCCGACGCGTCGAAGCCGCTGGTCCCCGTCTGCGACCC
CGCGATGTTCGCGGACCCCTCGCTGCTGTCCGGCGGCGGGTCCGTGGGCGGATCCAGGGCCCTGATTCCC
GCCGGCGACCCGGCGGTGCACGGCCCAGGTGTCGGAAACCCCGCCGGCGACCCGGCGGCGCGCGAGCCCG
AGACCTCGACTCCCGTCGGCGACCCGGCGGTGTACGGATTCGGTGCTGGAACTCCCGTCGGCGCCCCGGC
GGTGACAGCACCCGTGGGAACCGAGGGCGTGCCACGGGCCGTCGTCGAGTTCCTCGACGGTGACCGGACC
TGGACCGAGCAGGACGGAACGCTGCACGTGCCCGTGCTGCTCGGTCCCGGGCCGGTGCTCGTCGGGCCCG
TCGGAGTGGCGCCCGGCGTCTGGGAGGTCTTCCGGAACCGGGCCAGGGCCTGGGCGGACGCCGAGGGCGT
CGAACCGGCGGCCGGGCCCATCGCCCACTCCCTCGCGGGAGCCCTCGCCGCACAGCTCCTGACCGACGCC
CTCACGGGTGTCGCGGAGCCCGGTGAGGCCCACGTCGTGCACGGCCCTGATCTGACGGCCGACCGCGTCA
CCGTCACGGGCGCCCCCGTGCACGAAGCGGTCGCCGTCCGTCTCGGCGACGCGCCCGCCGAGCCGCTTCC
CGCCCCCGAGGCCGCGCTCGACGCCGCCGGTGTCCTCACCGCCCGCTGGACCGGCCTGTTCGCCTCCGCG
CAGGGCGAGCACCTGCCGCAGATGCCCCTCGCCCTGCGCGCGGCGGAGCACCGGGCGGACCGCACGGGCA
CGGTCACCGCCTGGGCCGCCCACCAGGAGACGGCGACCATCGCCGCCGCCCTGGCCGCCCTGCGCGACCG
CGCCGGCGGCACACCCGGCATCCCGGCGGCGGGCCTCACCAGGGAGCACTGGCTGCTCGACGGCGCCCTG
CGTCACCTCGCGGGGGCCAAGCAGGCCTTCGTCCCCGACGCGGACGCCCCACTGCACGCCGAAGGCCACC
GGGTCCACGCCGAGTTGTGGTCGCTGCTCGGCAGGGAAAGGGAGGGAGGGAACGCAGCCGAACCCGTCCT
CGTCCTGGCCCGGCACGCCGGTGTCGGCTGGCCGCTGGCCGAGGTCACCCTAGACGGGCGGACGCTCGGC
GCCGGCTGGGGCCCGACCGCCACCGACGCGACGTACGCCGCGCTGTGCACGGCACTCGCCGCCGCGCAGA
CCGGCGGCACGGCCGGCCGGCTCTCCACCGACGCCCTGCTGACCGCGGACGACGCCGTCCGGGCCGCGCT
GCGGGAACAGCTCACCGCGCTCGCCGGCTACCGGGGGCGGCCCCGCCGCACCGACCCGGTGCTCGGTGAA
CTCCCCTTCTGGTACGGCCCGGTGACCGTCCCGACCGACCTCACCGCCGAGGAGTCCGCCGATGCCGACC
ACTGA
 Primer design

Protein Sequence:654 a.a.
>SchaN1_010100008065|ThioFinder1632 Streptomyces chartreusis NRRL 12338
MTVTDVDRTPARTAAGAGAASLKARPGLHYAPVPGGVYFSGTRGQFVLRGSELLYAVADGCVPLLRAGTT
EDALVAEFGTERARPAVRHLLTKLRENGLLLDPAALTEPEPPAEVAALHAGTLARLTARLDDPYAAFARL
RRARVRLHGPATATAPALRGLRRAGVTDVTATTVPDASKPLVPVCDPAMFADPSLLSGGGSVGGSRALIP
AGDPAVHGPGVGNPAGDPAAREPETSTPVGDPAVYGFGAGTPVGAPAVTAPVGTEGVPRAVVEFLDGDRT
WTEQDGTLHVPVLLGPGPVLVGPVGVAPGVWEVFRNRARAWADAEGVEPAAGPIAHSLAGALAAQLLTDA
LTGVAEPGEAHVVHGPDLTADRVTVTGAPVHEAVAVRLGDAPAEPLPAPEAALDAAGVLTARWTGLFASA
QGEHLPQMPLALRAAEHRADRTGTVTAWAAHQETATIAAALAALRDRAGGTPGIPAAGLTREHWLLDGAL
RHLAGAKQAFVPDADAPLHAEGHRVHAELWSLLGREREGGNAAEPVLVLARHAGVGWPLAEVTLDGRTLG
AGWGPTATDATYAALCTALAAAQTGGTAGRLSTDALLTADDAVRAALREQLTALAGYRGRPRRTDPVLGE
LPFWYGPVTVPTDLTAEESADADH