Home 

Gene Symbol:  
SchaN1_010100008055
Organism:  
Streptomyces chartreusis NRRL 12338
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1057..2130 [1], 1074 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_09951904.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1074 bp
>SchaN1_010100008055|ThioFinder1630 Streptomyces chartreusis NRRL 12338
ATGCCGGTGACACCGGCCTGGCTTGCGCGGCACGTCGTCCCGGTCGCCCGCGGACTGGGCGAGCGGGGCG
TACCCGGCGTACAGGTGCGGCGCGGCTGGCTGCACGGACCGCACGTCGACGTGCTCGCCCCGGTGGGTGC
GGGGGCGCCCGGCGGGGCCGTCGACTGGGCGGGGATCGAGGCCGGGCTGGACGCCGGCCCCCTCGATCCG
GCCCGGGCGCTGACCGAGGAGGTGTATCTGGAGCAGGCCCGGGAGTTCGGCCGGCTCGAAGCGGTGGAGC
CCCCGTACCTGCCGCTGCGCGAGCACGGCGCGGTGCTGCGCGTCGGCCCCGGCGACCCCGCGCTGCGCTC
CCGGGAACCGCGCCTGGACGCCCTGCGCACCGTGGTGTACGGCGCCCTCGCGACGCCGGTGCTGTCGATG
ATCGAGGGCCTGGCCGAGGAACCGGGCAGCGGCACGGTCCGCCTCGCGGAGGCGTTCGCCGCCCTCGTCG
ACACGCATGCGCTCGGACCGGCGTACGGGGTGTTCTCGCCCCGGTCGCACGTGGAGGCGTTCCTCGCCTG
GGCGGCTCCGCGCAAGGACATGCGCCCGGTCTTCCAGGAGCGCCTCGCCAAGGAGGCGCCCCGGATCCGC
GAGGTCGTCGAACAGCGCCTGAACGGTGCGGTGTCGCCGGCGGCGGCCCAGTGGCGCACCGCGTTCGCCT
ACGGCGCCGGGGTCCTGGACCACGCCGTCGCCACCGGCGCCCTCACCCCGGACCTGCTGGACTCCGTCAC
CGACGGCGTCGACCGCAGCCGGATGGGCCCGCCCGGGGCCGAGACGGCGGTGCCGCGCGGCGAGCAGCCG
GACACCGACTTCCACCGGACCGTGCACGGCTCCGGGGCGATCAGCACCCCGTCCCCGTTCTTCGCCGCCT
ACCGCCTGCTGACGAACCTCTTCTACCAGCAGCTGCCCCTGCTCACGGTCTCGCCGATGCAGCGCTACTA
CATGTGCTTCGCCCTCGCCGAGACGGTGGACGAGGTACTCGGCAGCAGCTGGCGGGAGCGCCTGACCACC
ACGGAGACGGGAGCCCCGCGATGA
 Primer design

Protein Sequence:357 a.a.
>SchaN1_010100008055|ThioFinder1630 Streptomyces chartreusis NRRL 12338
MPVTPAWLARHVVPVARGLGERGVPGVQVRRGWLHGPHVDVLAPVGAGAPGGAVDWAGIEAGLDAGPLDP
ARALTEEVYLEQAREFGRLEAVEPPYLPLREHGAVLRVGPGDPALRSREPRLDALRTVVYGALATPVLSM
IEGLAEEPGSGTVRLAEAFAALVDTHALGPAYGVFSPRSHVEAFLAWAAPRKDMRPVFQERLAKEAPRIR
EVVEQRLNGAVSPAAAQWRTAFAYGAGVLDHAVATGALTPDLLDSVTDGVDRSRMGPPGAETAVPRGEQP
DTDFHRTVHGSGAISTPSPFFAAYRLLTNLFYQQLPLLTVSPMQRYYMCFALAETVDEVLGSSWRERLTT
TETGAPR