Home 


Precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
tpdAACS83781.149 thiomuracin prepropeptide
Sequence:  
MDLSDLPMDVFELADDGVAVESLTAGHGMTEVGASCNCFCYICCSCSSA
SCNCFCYICCSCSSA
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder