Home 


Precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
tpdAACS83766.157 GE2270 prepropeptide
Sequence:  
MSELESKLNLSDLPMDVFEMADSGMEVESLTAGHGMPEVGASCNCVCGFCCSCSPSA
SCNCVCGFCCSCSPSA
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder