Home 


Precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
BC5087NP_834755.152 putative lantibiotic precursor peptide
Sequence:  
MSEIKKALNTLEIEDFDAIEMVDVDAMPENEALEIMGASCTTCVCTCSCCTT
SCTTCVCTCSCCTT
  
BC5088NP_834756.152 putative lantibiotic precursor peptide
Sequence:  
MSEIKKALNTLEIEDFDAIEMVDVDAMPENEALEIMGASCTTCVCTCSCCTT
SCTTCVCTCSCCTT
  
BC5089NP_834757.152 putative lantibiotic precursor peptide
Sequence:  
MSEIKKALNTLEIEDFDAIEMVDVDAMPENEALEIMGASCTTCVCTCSCCTT
SCTTCVCTCSCCTT
  
BC5090NP_834758.152 putative lantibiotic precursor peptide
Sequence:  
MSEIKKALNTLEIEDFDAIEMVDVDAMPENEALEIMGASCTTCVCTCSCCTT
SCTTCVCTCSCCTT
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder