Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
VAB18032_21150YP_004405930.160 hypothetical protein
Sequence:  
MPITLNDELRELETETFEIEEVADGEEMLAATSSSCSCSSCCSCSTSSCCSTSTSTSSCG
  
orf_propep *61 putative thiopeptide propeptide, predicted by Prodigal
Sequence:  
MPELTEELRALETETFEIEDVDAIDAMVMDWSSSSCSCSSCCSCSTSSCCSSSTSTGCGGG
  

*  : Newly annotated short orf that was missed in the original genome annotation at GenBank

    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder