Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
MCAG_03948ZP_04607691.187 hypothetical protein
Sequence:  
MPPTHPDTALCGWRAIHRKRIEQRKEERMDANATTVGVDGLTGLDIDTFEIGDYLDETVLDTADLTETMT SSSSCTTCICTCSCSS
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder