Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
SACT1_4717ZP_08238125.158 putative lantibiotic precursor
Sequence:  
MAPKTELATLADEILELESETFEISDYSDASEVVLAGSTSCSSTSTCSSTTSTTSCSA
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder