Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
SSHG_03904ZP_06593001.169 predicted protein
Sequence:  
MDPWDRREYAMTPKTELATLADEILELESETFEISDYSDAAEVVLAGSTSCSSTSTCSSTTSTTSCSA
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder