Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
SVEN_5130CCA58416.157 hypothetical protein
Sequence:  
MSDDIKQGQDADKAFENFDVDELETLEVAQGVALPEMGASSGSIGTSSSSSSTCSAC
  
SVEN_5131CCA58417.156 hypothetical protein
Sequence:  
MSIDDIKNGDDAAFDNFDVAELETLEVAQGVALPEMGASSGSIGTSSSSSSTCSAC
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder