Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
Caci_3697YP_003114440.165 lantibiotic precursor
Sequence:  
MQIHTTETLEDTSVTALAAEILALESETFEITDYSDASEVMLGSSTSCSSTSTCSSTTSTTSCSA
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder