Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
Bsph_4019YP_001699617.157 hypothetical protein
Sequence:  
MKKEMHTQEVNTNEFDLEVELLDLDEVSAIPETTASSGSTSCSASSTCGSTSCCGSC
  
Bsph_4020YP_001699618.157 hypothetical protein
Sequence:  
MKKEMNTQTVNAKEFDLEVELLDLDEVSAIPETTASSGSTSCSASSTCGSTSCCGSC
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder