Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
Haur_0911YP_001543687.162 hypothetical protein
Sequence:  
MADVKNLIDAEVTAAETELFADELEEHVTNVAAACVSSLGSLSTSGTICTVSTFCTAAIEAQ
  
Haur_0912YP_001543688.162 hypothetical protein
Sequence:  
MSDVKNLIDAEVTAAETELFADELEEHVTNVAAACVSSLGSLSTSGTICTVSTFCTAAIEAQ
  
Haur_0913YP_001543689.162 hypothetical protein
Sequence:  
MSDVKNLIDAEVTAGETELFADELEEHVTNAAAACVSSLGSLSTSGTICTVSTFCTAAIEAQ
  
Haur_0914YP_001543690.162 hypothetical protein
Sequence:  
MSDVKNLIDAEVTAAETELFADELEEHVSNAAAACVSSLGSLSTSGTICTVSTFCTAGVAEK
  
Haur_0915YP_001543691.162 hypothetical protein
Sequence:  
MSDVKNLIDAEVTAAETELFADELEEHVTNVAAACVSSLGSLSTSGTICTVSTFCTAAIEAQ
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder