Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
BB14905_21618ZP_01724937.157 hypothetical protein
Sequence:  
MEKDLRKKELSANEFDLEVELLDLDEVSAIPETTASSGSTSCSASSTCGSTSCCGSC
  
BB14905_21623ZP_01724938.157 hypothetical protein
Sequence:  
MKKEMTTQTVNAKEFDLEVELLDLDEVSAIPETTASSGSTSCSASSTCGSTSCCGSC
  
BB14905_21628ZP_01724939.157 hypothetical protein
Sequence:  
MKKEMHTQEVTTKEFDLEVELLDLDEVSAIPETTASSGSTSCSASSTCGSTSCCGSC
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder