Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
BCE_G9241_0514ZP_00237834.157 hypothetical protein protein
Sequence:  
MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGSSGCSASSTCGSSSCCGSC
  
BCE_G9241_0515ZP_00237835.157 hypothetical protein protein
Sequence:  
MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGSSGCSASSTCGSSSCCGSC
  
BCE_G9241_0517ZP_00237837.157 hypothetical protein protein
Sequence:  
MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGTSSCSASSTCGSSSCCGSC
  
BCE_G9241_0510ZP_00237830.180 hypothetical protein protein
Sequence:  
MVKSIIKARESGRFYETKYLKGGEEMKEQKELKNEEFELDVEFLDLDEVSAIPETTASSGTSSCSASSTC GSSSCCGSC
  
BCE_G9241_0512ZP_00237832.157 hypothetical protein protein
Sequence:  
MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGTSSCSASSTCGSSSCCGSC
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder