Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
SSMG_08024ZP_07283984.152 predicted protein
Sequence:  
MNEFDTQVEQAFAEDVTVEELGEVAGAGTTNTGGTISSTTCPACIGTAFSWS
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder