Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
BC059799_0517ZP_03108626.157 hypothetical protein
Sequence:  
MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGSSGCSASSTCGSSSCCGSC
  
BC059799_0518ZP_03108677.157 hypothetical protein
Sequence:  
MKEQKEQKELKNEEFELDVEFLDLDEVSAIPETTASSGSSGCSASSTCGSSSCCGSC
  
BC059799_0519ZP_03108630.157 hypothetical protein
Sequence:  
MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGTSSCSASSTCGSSSCCGSC
  
BC059799_0516ZP_03108602.157 hypothetical protein
Sequence:  
MKEQKELKELKNEEFELDVEFLDLDEVSAIPETTASSGTSSCSASSTCGSSSCCGSC
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder