Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
BATR1942_14085YP_003974670.157 hypothetical protein
Sequence:  
MSEKDTSIKTLELYAEELPAQVDLATVAGTASTASSFTTASCPATTASTAGSASSYG
  
BATR1942_14095YP_003974672.155 hypothetical protein
Sequence:  
MEKDKMHELELFAEELPEQVDLATIAASFSSTSSVSTASCPGTTAASAGTVSCYG
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder