Home 


Precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
getAAEM00614.157 GE37468 structural preprotein
Sequence:  
MGNNEEYFIDVNDLSIDVFDVVEQGGAVTALTADHGMPEVGASTNCFCYICCSCSSN
STNCFCYICCSCSSN
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder