Home 


Predicted putative precursor peptide Information:

Gene Symbol Product Locus Length (a.a.) Product
Cp3995_1666YP_005123770.158 Hypothetical protein
Sequence:  
MTNMQRDTMSDLNLDLLSMEIEGLEVNDYVDADDTAFFSMCSSTTSSSSCISTSSSSS
  


    link biosynthetic gene cluster for thiopeptide antibiotics

    link browse all precursor peptides in ThioFinder